SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180498|ref|YP_008953023.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180498|ref|YP_008953023.1|
Domain Number 1 Region: 1-189,361-568,606-638
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.05e-135
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000571
Further Details:      
 
Domain Number 2 Region: 639-896
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.46e-72
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000445
Further Details:      
 
Domain Number 3 Region: 188-362
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.83e-58
Family ValRS/IleRS/LeuRS editing domain 0.0000447
Further Details:      
 
Domain Number 4 Region: 881-945
Classification Level Classification E-value
Superfamily tRNA-binding arm 7.85e-17
Family Valyl-tRNA synthetase (ValRS) C-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568180498|ref|YP_008953023.1|
Sequence length 948
Comment valyl-tRNA synthetase [Pseudomonas monteilii SB3078]
Sequence
MDKTYQPHAIETSWYNTWESENYFAPQGAGESYTIMIPPPNVTGSLHMGHGFNNAIMDAL
IRFRRMQGRDTLWQPGTDHAGIATQMLVERQLEAKGQNRHDLGREKFLEKVWEWKDQSGG
NISRQIRRLGSSVDWSRERFTMDDGLSEAVKEAFVRLHEDGLIYRGKRLVNWDTKLHTAI
SDLEVENHDEKGHLWNLRYPLADGAKTAEGKDYLVVATTRPETLLGDAAVAVNPNDERYQ
ALIGKFVELPLVGRRIPIIADDYCDPEFGTGCVKITPAHDFNDYEVGKRHNLPLLNIFDK
NAFVLASAQAFNLDGSVNEQVDTRLPAQYANLDRFVARKQIVADLDAQGLLVSIDDHALK
VPKGDRSGTVIEPWLTDQWYVSTKPLAEPAIAAVEDGRIQFVPKQYENMYFSWMRDIQDW
CISRQLWWGHRIPAWYDEAGQVYVGRNEEEVRAKHNLGADVVLRQDDDVLDTWFSSGLWT
FSTLGWPEQTEFLKKFHSTDVLVTGFDIIFFWVARMIMLTMHLIKNEDGTPQVPFKTVYV
HGLVRDGQGQKMSKSKGNVLDPLDIVDGITLDALLEKRTSGMMQPKLAEKIAKQTKAEFP
EGIASYGTDALRFTFCSLASTGRDIKFDMGRVEGYRNFCNKIWNAARYVLDKGEDCGQNG
EAYELSLADRWIISQLQRTEAEVTRQLEQFRFDLASQALYEFIWNQYCDWYLELSKPVLW
DENAPVERARGTRRTLVRVLEVALRLAHPFMPFITEEIWQRIAPLAGIEGKTIMLQPWPV
ANESRIDAAAEGDIEWLKELMVGLRNIRAEMNIGPGKPLPLFLKNANADDQRRLQENEAL
LKKLAKVESFTVLGDADEAPLSATALVGDLQVLVPMAGLIDKDAELARLNKEIQRLQGEV
ARVGGKLSNAAFVDKAPPAVIEKERAKLAESEQALANFTEQHARIAAL
Download sequence
Identical sequences A0A059UW83 A0A099MW91 A0A0C1I1V7 F8FX78 V9UUT5 V9WTB8
gi|339485936|ref|YP_004700464.1| gi|568185929|ref|YP_008958452.1| gi|568180498|ref|YP_008953023.1| WP_013971095.1.1643 WP_013971095.1.23948 WP_013971095.1.28354 WP_013971095.1.32670 WP_013971095.1.35335 WP_013971095.1.56258 WP_013971095.1.61620 WP_013971095.1.65739 WP_013971095.1.7288 WP_013971095.1.7435 WP_013971095.1.76210 WP_013971095.1.80759 WP_013971095.1.92076 WP_013971095.1.9402 WP_013971095.1.95946 WP_013971095.1.99927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]