SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180586|ref|YP_008953111.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180586|ref|YP_008953111.1|
Domain Number 1 Region: 180-325
Classification Level Classification E-value
Superfamily CBS-domain pair 9.22e-24
Family CBS-domain pair 0.0051
Further Details:      
 
Domain Number 2 Region: 319-399
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.26e-17
Family CorC/HlyC domain-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568180586|ref|YP_008953111.1|
Sequence length 401
Comment hypothetical protein X969_03710 [Pseudomonas monteilii SB3078]
Sequence
MDTLPYAPLFGTLALALLWSALFTAVDAARLQLNGTLRTGEDGQPVLPAQALVLCASLGK
LLVLGLACLLGQRHSGEHGFWLAGLAATLVLLVFAEYLPRRLARRNPQAFVSLGTSLLKV
PLALLQPLACLLDGMAKLILRPFRVQPTAVALHPQEADEFDEDEEHEAPRHGLLDGLQSL
DKMTVNDILVPRNEVDGISLDEPIERIIEQLIVSRHTRLPVYHSDINQVEAILNTKLISH
LLPKAELTLEMLLGACYEPYFVPESTPLQMQLLNFHKQQRRLGVVVDEYGEVLGIVTLED
ILEEIVGEFEDEHSLDNPHVHPQPDGTFVIDGTASLREINRSLGWHLPCDGGPKTLNGLV
TEALESIPESAVCLKIGRYRLEILETEDNCASKVLVWTVTR
Download sequence
Identical sequences A0A059UT17 A0A099MWD2 V9UTH9
WP_024086384.1.23948 WP_024086384.1.28354 WP_024086384.1.35335 WP_024086384.1.65739 WP_024086384.1.7288 WP_024086384.1.80759 gi|568186017|ref|YP_008958540.1| gi|568180586|ref|YP_008953111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]