SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180596|ref|YP_008953121.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180596|ref|YP_008953121.1|
Domain Number 1 Region: 135-300
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.57e-52
Family Homoserine dehydrogenase-like 0.001
Further Details:      
 
Domain Number 2 Region: 1-156
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.1e-36
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.062
Further Details:      
 
Domain Number 3 Region: 350-421
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000000651
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180596|ref|YP_008953121.1|
Sequence length 434
Comment homoserine dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MKPVKVGICGLGTVGGGTFNVLQRNAEEIARRAGRGIEVAQIAMRSQNPNCQITGTPITA
DVFEVASNPEIDIVIELIGGYTVARELVLKAIENGKHVVTANKALIAVHGNEIFAKAREK
GVIVAFEAAVAGGIPVIKAIREGLSANHINWLAGIINGTGNFILTEMREKGRAFPDVLAE
AQALGYAEADPTFDVEGIDAAHKLTILASIAFGIPLQFDKAYTEGITQLTTADVNYAEAL
GYRIKHLGVARRTAEGIELRVHPTLIPADRLIANVNGVMNAVMVNGDAAGSTLYYGAGAG
MEPTASSVVGDLVDVVRAMTSDPENRVPHLAFQPDSLSAHPILPIEACESAYYLRIQAKD
HPGVLAQVASILSERGINIESIMQKEAEEQDGLVPMILLTHRVVEQRINDAIVALEALQD
VIGKVVRIRVEQLN
Download sequence
Identical sequences A0A059UT23 A0A099MWE0 A0A0C1I240 A0A136QL21 J8V2A7 L0FHC4 V7DGT0 V9UTJ1
gi|431801090|ref|YP_007227993.1| gi|568186027|ref|YP_008958550.1| gi|568180596|ref|YP_008953121.1| WP_003259434.1.1643 WP_003259434.1.23948 WP_003259434.1.28354 WP_003259434.1.35335 WP_003259434.1.57632 WP_003259434.1.65739 WP_003259434.1.71677 WP_003259434.1.7288 WP_003259434.1.7435 WP_003259434.1.80759 WP_003259434.1.95946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]