SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180603|ref|YP_008953128.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180603|ref|YP_008953128.1|
Domain Number 1 Region: 44-457
Classification Level Classification E-value
Superfamily DHH phosphoesterases 9.16e-122
Family Exonuclease RecJ 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180603|ref|YP_008953128.1|
Sequence length 569
Comment ssDNA exonuclease RecJ [Pseudomonas monteilii SB3078]
Sequence
MRIEPRPLPPTLPFLGNLPPLLTRLYAARGVQSEAELDKSLARLLPYQQLKGIEAGVDLL
VEAIDQRQRILIVGDFDADGATASTVGVLGLRLLGAAHVDYLVPNRFEYGYGLTPEIVEV
ALQRQPQLLITVDNGISSVDGVAAAKAAGLKVLVTDHHLPGAELPDADAIINPNQPGCSF
PSKALAGVGVIFYVLMALRARLRSLGRYETQPQPNIGELLDLVALGSVADVVPLDANNRI
LVHQGLERIRAGRARPGLKAILEVARRDHRRITSTDLGFILGPRLNAAGRLDDMSLGIEC
LLCEDAALAQDMAQQLDDLNQDRKSIEQGMQREALAQLKDLPVESMPYGLCLFDADWHQG
VIGILASRLKERYHRPTIAFADAGEGMLKGSARSVPGFHIRDALDAVAARHPHLISKFGG
HAMAAGLSLPEANFPAFAEAFDEEVRRQLREEDLTGRLLSDGSLAVEEFHLDLAKALRHA
GPWGQHFPEPLFHGVFQLVEQRVVGERHLKVVLKSECGSVRLDGIAFGIDREVWPNPTVR
WVELAYKLDVNEFRGNESVQLMIAHMEPR
Download sequence
Identical sequences A0A059UTS6 A0A0C1KKY0 F8FYP0 V9UV51
gi|568180603|ref|YP_008953128.1| WP_013971199.1.1643 WP_013971199.1.23948 WP_013971199.1.28354 WP_013971199.1.35335 WP_013971199.1.56258 WP_013971199.1.65739 WP_013971199.1.7288 WP_013971199.1.7435 gi|339486055|ref|YP_004700583.1| gi|568186034|ref|YP_008958557.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]