SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180608|ref|YP_008953133.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180608|ref|YP_008953133.1|
Domain Number 1 Region: 1-353
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.56e-116
Family FMN-linked oxidoreductases 0.0000000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180608|ref|YP_008953133.1|
Sequence length 368
Comment oxidoreductase [Pseudomonas monteilii SB3078]
Sequence
MSLLLEPYTLRQLTLPNRIAVSPMCQYSAVDGLANDWHLVHLGSRAVGGAGLVITEAVAV
TADGRITAEDLGLWDDAQIAPLQRITRFITAQGSVPGIQLAHAGRKASTYRPWLGKQGSV
KLEEGGWQPVGPSKIAFDPQHTTPHELNHNEIQAVISAFVASTERALKAGFKVVEIHAAH
GYLLHQFLSPLSNQRRDEYGSCFENRIRLTLQVVEAVRKVWPAELPLFVRVSATDWVEDG
WNPDETVELARRLRGLGVDLIDVSSGGTSVNAEIPTGPGYQTRFAERVRKESEIATGTVG
MITEPAQAEHILRTGQADIIFLARELLRDPYWPLHADDDLGGNKATWPAQYQRATSRANP
IHESDLRD
Download sequence
Identical sequences A0A059UWF6 A0A099MUA7 F8FYP2 V7DJC8 V9UV58
WP_013971201.1.23948 WP_013971201.1.28354 WP_013971201.1.35335 WP_013971201.1.56258 WP_013971201.1.65739 WP_013971201.1.7288 WP_013971201.1.80759 gi|568180608|ref|YP_008953133.1| gi|568186039|ref|YP_008958562.1| gi|339486057|ref|YP_004700585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]