SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180625|ref|YP_008953150.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180625|ref|YP_008953150.1|
Domain Number 1 Region: 28-99
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000277
Family Tetracyclin repressor-like, N-terminal domain 0.0078
Further Details:      
 
Weak hits

Sequence:  gi|568180625|ref|YP_008953150.1|
Domain Number - Region: 141-230
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.08
Family Tetracyclin repressor-like, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568180625|ref|YP_008953150.1|
Sequence length 234
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MPQQGAAGIATAVAESVQYQGRKTARQGSEQRRQLILDAAMRIVVRDGVRGVRHRAVAAE
AGVPLSATTYYFKDIEDLLTDTFAQYVERSAAYMAKLWANTEVVLRQLLAQGDGSPQARA
RLADEVARMTADYVQRQLLNRRDFLMAEQAFRQEALLCPRLAQLVCAHDQILLHGTRQLL
QVVGSQQPEQDAQMLTAIIEQMEYQGLLKDANAQADGQMLAMLSRYLQLVLASA
Download sequence
Identical sequences F8FZV8 V9UX01
WP_013971218.1.23948 WP_013971218.1.28354 WP_013971218.1.35335 WP_013971218.1.56258 WP_013971218.1.65739 WP_013971218.1.7288 WP_013971218.1.80759 gi|568186056|ref|YP_008958579.1| gi|339486075|ref|YP_004700603.1| gi|568180625|ref|YP_008953150.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]