SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180642|ref|YP_008953167.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180642|ref|YP_008953167.1|
Domain Number 1 Region: 11-91
Classification Level Classification E-value
Superfamily Homeodomain-like 2.54e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0082
Further Details:      
 
Domain Number 2 Region: 89-206
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000089
Family Tetracyclin repressor-like, C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568180642|ref|YP_008953167.1|
Sequence length 209
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MSNDAPIGPGRPKDLAKREAILEAAKALFLSLGYANTSMDAVAAAAGVSKLTVYSHFTDK
QTLFGSAVMATCQIQLPDMLFEYPEGVPVEEVLLTIARGFQALISSDEAVKLSRLIMAQG
SLDPSFGEYFYEAGPKRVLAGMEALLRGAHERGLLRIDNPLRAAEHFFCLVKGAPDYRLL
LGCAGPLEGDEAEAHVREVVGVFLRAFQP
Download sequence
Identical sequences V9UYA2
gi|568180642|ref|YP_008953167.1| gi|568186073|ref|YP_008958596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]