SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180663|ref|YP_008953190.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180663|ref|YP_008953190.1|
Domain Number 1 Region: 6-230
Classification Level Classification E-value
Superfamily Ribosomal protein S2 5.62e-94
Family Ribosomal protein S2 0.0000000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180663|ref|YP_008953190.1|
Sequence length 245
Comment 30S ribosomal protein S2 [Pseudomonas monteilii SB3078]
Sequence
MSQVNMRDMLKAGVHFGHQTRYWNPKMGKYIFGARNKIHIVNLEKTLPMFNDALSFVERL
AQGKNKILFVGTKRSAGKIVAEQAARCGSPYVDHRWLGGMLTNYKTIRASIKRLRDLETQ
AEDGTFAKLTKKEALMRSRDLEKLDRSLGGIKDMGGLPDALFVIDVDHERIAITEANKLG
IPVIGVVDTNSSPEGVDYIIPGNDDAIRAIELYMTSMADAVIRGRNNVAGGTEVYAEEAA
APAAE
Download sequence
Identical sequences A0A059UTW7 A0A099MUF5 A0A0A7Q319 A0A0C1HS45 A0A0E9ZPN6 A0A0H1BRK3 A0A0S4IBY4 A0A136QL85 A0A147GHN1 A0A160J108 A0A173HB99 A0A1L5PK29 A0A1W2DIG4 A0A212RJ66 A0A212SA43 A0A285YMY1 A0A285Z6M2 A0A2I0C467 A0A2K4LF32 A5W850 F8FZZ6 I3URQ0 L0FGH9 Q88MI0 V7D789 V9UVB4 V9WU46
gi|395445033|ref|YP_006385286.1| NP_743748.1.35174 WP_003252287.1.100978 WP_003252287.1.10502 WP_003252287.1.1079 WP_003252287.1.1090 WP_003252287.1.11138 WP_003252287.1.13472 WP_003252287.1.15314 WP_003252287.1.1643 WP_003252287.1.16466 WP_003252287.1.16597 WP_003252287.1.16675 WP_003252287.1.17434 WP_003252287.1.19681 WP_003252287.1.23948 WP_003252287.1.25319 WP_003252287.1.25626 WP_003252287.1.28157 WP_003252287.1.28295 WP_003252287.1.28354 WP_003252287.1.28475 WP_003252287.1.30017 WP_003252287.1.31265 WP_003252287.1.3142 WP_003252287.1.31851 WP_003252287.1.32670 WP_003252287.1.32932 WP_003252287.1.33269 WP_003252287.1.33515 WP_003252287.1.33725 WP_003252287.1.34900 WP_003252287.1.35335 WP_003252287.1.35716 WP_003252287.1.35841 WP_003252287.1.35996 WP_003252287.1.36333 WP_003252287.1.41 WP_003252287.1.41505 WP_003252287.1.42045 WP_003252287.1.42506 WP_003252287.1.43930 WP_003252287.1.44137 WP_003252287.1.45096 WP_003252287.1.45121 WP_003252287.1.45427 WP_003252287.1.47320 WP_003252287.1.48025 WP_003252287.1.52768 WP_003252287.1.54338 WP_003252287.1.5613 WP_003252287.1.56258 WP_003252287.1.57632 WP_003252287.1.58218 WP_003252287.1.59340 WP_003252287.1.59535 WP_003252287.1.60844 WP_003252287.1.61620 WP_003252287.1.62279 WP_003252287.1.62773 WP_003252287.1.62816 WP_003252287.1.63009 WP_003252287.1.6330 WP_003252287.1.64196 WP_003252287.1.64740 WP_003252287.1.65173 WP_003252287.1.65739 WP_003252287.1.66713 WP_003252287.1.675 WP_003252287.1.67665 WP_003252287.1.71439 WP_003252287.1.71479 WP_003252287.1.71624 WP_003252287.1.71677 WP_003252287.1.72006 WP_003252287.1.7288 WP_003252287.1.73516 WP_003252287.1.7435 WP_003252287.1.74642 WP_003252287.1.75010 WP_003252287.1.75189 WP_003252287.1.76210 WP_003252287.1.76710 WP_003252287.1.78345 WP_003252287.1.78427 WP_003252287.1.80759 WP_003252287.1.83952 WP_003252287.1.84148 WP_003252287.1.87606 WP_003252287.1.89748 WP_003252287.1.9033 WP_003252287.1.92076 WP_003252287.1.93113 WP_003252287.1.9402 WP_003252287.1.95600 WP_003252287.1.95946 WP_003252287.1.96951 WP_003252287.1.98215 WP_003252287.1.99927 gi|431801158|ref|YP_007228061.1| gi|568186094|ref|YP_008958619.1| 160488.PP_1591 351746.Pput_4186 gi|339486113|ref|YP_004700641.1| gi|148549392|ref|YP_001269494.1| gi|386013535|ref|YP_005931812.1| gi|568180663|ref|YP_008953190.1| gi|26988323|ref|NP_743748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]