SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180669|ref|YP_008953196.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180669|ref|YP_008953196.1|
Domain Number 1 Region: 129-272
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 2.65e-60
Family Dihydrodipicolinate reductase-like 0.00000442
Further Details:      
 
Domain Number 2 Region: 4-153
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.84e-47
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 300-393
Classification Level Classification E-value
Superfamily 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain 1.44e-31
Family 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180669|ref|YP_008953196.1|
Sequence length 396
Comment 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Pseudomonas monteilii SB3078]
Sequence
MSRPQRITVLGATGSIGLSTLDVIARHPDRYQVFALSGYSRIDELLALCVRHRPTFAVVP
NAEAAARLRESLVAAGCATEVLEGEAGLCQVASASEVDAVMAAIVGAAGLRPTLAAVEAG
KKVLLANKEALVMSGALFMEAVRRSGAVLLPIDSEHNAIFQCMPGDYARGLSAVGVRRIL
LTASGGPFRETPVEALLDVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAA
PAKVEVVVHPQSVIHSLVDYVDGSVLAQLGNPDMRTPIANALAWPERIDSGVAPLDLFAI
ARLDFQAPDEQRFPCLRLARQAAEAGNSAPAVLNAANEVAVEAFLQRRIRFPEIAGMIEQ
VLDQEPVVPLPSLDAVFAADQRARELSREWLRRHGR
Download sequence
Identical sequences A0A0C1I1P5 V9UW08
WP_024086395.1.23948 WP_024086395.1.28354 WP_024086395.1.7288 WP_024086395.1.7435 gi|568186100|ref|YP_008958625.1| gi|568180669|ref|YP_008953196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]