SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180691|ref|YP_008953218.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180691|ref|YP_008953218.1|
Domain Number 1 Region: 1-247
Classification Level Classification E-value
Superfamily SurE-like 1.83e-80
Family SurE-like 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180691|ref|YP_008953218.1|
Sequence length 249
Comment stationary phase survival protein SurE [Pseudomonas monteilii SB3078]
Sequence
MRILISNDDGVTAPGIAALHAALVDYAECVVIAPDQDKSGASSSLTLDRPLHPQTLANGF
ISLNGTPTDCVHLGLNGLLPQAPDMVVSGINLGANLGDDVLYSGTVAAALEGRFLGGTSL
AFSLLSRQPDNLPTAAHIARRLVEAQSRLALPPRTVLNVNIPNLPLEHIRGIQLTRLGHR
ARAAAPTKVVNPRGKEGYWIAVAGDAEDGGPGTDFHAVMQGYVSITPLQLDRTFSDAFEQ
LDGWLEGLL
Download sequence
Identical sequences A0A059UQF7 A0A099MWQ6 A0A0C1KAS7 A0A136QLA0 F8G024 L0FHD0 V7D695 V9UTU6
2035932047 gi|568186122|ref|YP_008958647.1| WP_013971274.1.1643 WP_013971274.1.23948 WP_013971274.1.28354 WP_013971274.1.35335 WP_013971274.1.56258 WP_013971274.1.57632 WP_013971274.1.65739 WP_013971274.1.71677 WP_013971274.1.7288 WP_013971274.1.7435 WP_013971274.1.80759 WP_013971274.1.95946 gi|568180691|ref|YP_008953218.1| gi|339486141|ref|YP_004700669.1| gi|431801186|ref|YP_007228089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]