SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180770|ref|YP_008953298.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180770|ref|YP_008953298.1|
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 1.06e-18
Family Multidrug resistance efflux transporter EmrE 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180770|ref|YP_008953298.1|
Sequence length 105
Comment multidrug transporter [Pseudomonas monteilii SB3078]
Sequence
MSWIILFFAGLFEVGWAVGLKYTDGFSKPLPTILTVAAMAISLGLLGLAMKELPLGTAYA
IWTGVGAVGTVIAGIILFGESMALVRLVSVALIITGLVGLKVSAS
Download sequence
Identical sequences A0A059UY02 A0A099MWU4 F8G2M2 V9UXG0
gi|568180770|ref|YP_008953298.1| gi|568186201|ref|YP_008958727.1| gi|339486275|ref|YP_004700803.1| WP_013971399.1.23948 WP_013971399.1.28354 WP_013971399.1.35335 WP_013971399.1.56258 WP_013971399.1.65739 WP_013971399.1.7288 WP_013971399.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]