SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180816|ref|YP_008953344.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180816|ref|YP_008953344.1|
Domain Number 1 Region: 44-144
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000111
Family Multidrug resistance efflux transporter EmrE 0.01
Further Details:      
 
Weak hits

Sequence:  gi|568180816|ref|YP_008953344.1|
Domain Number - Region: 201-303
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00745
Family Multidrug resistance efflux transporter EmrE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568180816|ref|YP_008953344.1|
Sequence length 320
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MHTITGRWGYGLFLALLTALLWGILPIKLKQVLQVVDPVTVTWYRLLVSGGLLFAWLAAK
RRLPSFSKLTPKGKGLVLVAVLGLMGNYVLYLIGLNRLSPGTAQLVVQIGPVLLLVASVF
VFRERFSLGQGVGLLILLAGFGLFFNQRLEELLTSLGTYTTGVLTILLATSVWVFYALSQ
KQLLTVWHSQQVMMVIYLSCAALLIPWAHPLEALQLTSVQGWLLLACCLNTLVAYGAFAE
ALAHWEASRVSATLALTPLVTFVAVALAALAWPDYVHAEDINALSYVGAVTVVLGSALVA
LGPSLVAGWRARRARLAQAQ
Download sequence
Identical sequences V9UU81
gi|568180816|ref|YP_008953344.1| gi|568186247|ref|YP_008958773.1| WP_024086440.1.23948 WP_024086440.1.28354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]