SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180954|ref|YP_008953487.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180954|ref|YP_008953487.1|
Domain Number 1 Region: 212-338
Classification Level Classification E-value
Superfamily Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 2.49e-47
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase, MurB, C-terminal domain 0.0000314
Further Details:      
 
Domain Number 2 Region: 10-197
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.76e-45
Family Uridine diphospho-N-Acetylenolpyruvylglucosamine reductase (MurB), N-terminal domain 0.0000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180954|ref|YP_008953487.1|
Sequence length 339
Comment UDP-N-acetylenolpyruvoylglucosamine reductase [Pseudomonas monteilii SB3078]
Sequence
MTVQWQEQVSLKPYNTFGIDVKARYFTQAHDDQEVRLALAQARQGGVPVLVIGGGSNLLL
TRDIDALVLHMASRGRRVLSDDGERIVVEAEAGEPWHPFVQWTLAQGYCGLENLSLIPGT
VGAAPMQNVGAYGVEIKDVFVGLTALDRETGELRDFGLAECAFGYRDSLFKRNPGRWLIL
RVRFALSRTLQAHLDYGPVRQRLAEQGVTEPTAQAISEAICSIRREKLPDPAELGNAGSF
FKNPVVSAELVERIRAQYPGVVAYPQADGQVKLAAGWLIEQAGWKGHREGDAGVHRLQSL
VLVNYGQASGAQMHALARRIQADILERFGVELEMEPNLY
Download sequence
Identical sequences A0A059UQX9 V7D8G8 V9UWU7
gi|568186385|ref|YP_008958916.1| gi|568180954|ref|YP_008953487.1| WP_023662429.1.23948 WP_023662429.1.28354 WP_023662429.1.35335 WP_023662429.1.65739 WP_023662429.1.7288 WP_023662429.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]