SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180986|ref|YP_008953520.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180986|ref|YP_008953520.1|
Domain Number 1 Region: 2-309
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.41e-69
Family FMN-linked oxidoreductases 0.0000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568180986|ref|YP_008953520.1|
Sequence length 323
Comment tRNA-dihydrouridine synthase C [Pseudomonas monteilii SB3078]
Sequence
MQIALAPMEGLVDNILRDVLTRVGGIDWCVTEFIRVCDRLLPPSSFDKLAPELRNGARTA
AGVPMRVQLLGSDPVCLAENAALACQLGAPVIDLNFGCPAKTVNKSRGGAVLLKEPELLH
AIVREVRRAVPAHIPVTSKMRLGFDSPDGALECATALAEGGSAHLVVHARTKVEGYKPPA
HWEWVARVQDVVKVPVFANGEIWTVDDWRRCREVSGAEDIMLGRGLVSRPDLGLQIAAAR
DGREYQPMSWDDLLPLLREFWRQAQAKLSPRYAPGRMKQWLAMLTRSYPEAVVLFAELRR
EDDCARISRLLGVEAVSLEACVA
Download sequence
Identical sequences A0A059UQZ4 A0A099MXV0 V7DHH6 V9UUM4
gi|568180986|ref|YP_008953520.1| WP_023660793.1.1643 WP_023660793.1.23948 WP_023660793.1.28354 WP_023660793.1.35335 WP_023660793.1.65739 WP_023660793.1.7288 WP_023660793.1.80759 gi|568186417|ref|YP_008958949.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]