SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180994|ref|YP_008953528.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180994|ref|YP_008953528.1|
Domain Number 1 Region: 134-355
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 2.06e-77
Family GAPDH-like 0.0000000137
Further Details:      
 
Domain Number 2 Region: 1-147
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.28e-53
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00000416
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568180994|ref|YP_008953528.1|
Sequence length 370
Comment aspartate-semialdehyde dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MKRVGLIGWRGMVGSVLMQRMLEEQDFDLIEPVFFTTSNVGGQGPNVGKDTAPLKDAYSI
EELKTLDVILTCQGGDYTNEVFPKLREAGWQGYWIDAASSLRMQDDAVIILDPVNRKVID
QQLDAGTKNYIGGNCTVSLMLMGLGGLFEAGLVEWMSAMTYQAASGAGAQNMRELIKQMG
ATHAAVADDLANPASAILDIDRKVAETMRSEAFPTENFGVPLAGSLIPWIDKELPNGQSR
EEWKAQAETNKILGRFKSPIPVDGICVRIGAMRCHSQALTIKLNKDVPLADIEGMISQHN
PWVKLVPNQREISMQELTPTKVTGTLNIPVGRLRKLNMGSQYLGAFTVGDQLLWGAAEPL
RRMLRILLER
Download sequence
Identical sequences A0A059UYP8 A0A099MVQ8 V7DH78 V9UWY4
gi|568180994|ref|YP_008953528.1| WP_023660790.1.23948 WP_023660790.1.28354 WP_023660790.1.35335 WP_023660790.1.56258 WP_023660790.1.65739 WP_023660790.1.7288 WP_023660790.1.80759 gi|568186425|ref|YP_008958957.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]