SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568180995|ref|YP_008953529.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568180995|ref|YP_008953529.1|
Domain Number 1 Region: 132-317
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 7.4e-53
Family GAPDH-like 0.00000093
Further Details:      
 
Domain Number 2 Region: 5-152
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.4e-36
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568180995|ref|YP_008953529.1|
Sequence length 334
Comment aspartate-semialdehyde dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MTHPLDIAVVGATGSVGEALVQILEELDFPVATLHLLASMESAGSSVMFAGKKLKVREVD
SFDFAQAKLAFFAAGAAVSRSFASKALQAGCTVIDLSADLDDALALVPEANAERLVDLAL
PARIVSPCSAAVALAVALAPLKRLLDIERVQVMAALAVSAQGREAVNELARQTAELLNAR
PLEPRFFDRQVAFNMLAQVGAADEQGHTALERRLVGELRVLLGLPELKISVSCVQVPVFF
GDSFSVAVQSRRPVDLEAVNQALEAADSVELVERDDYPTPVGDAVGQDVVYVGRVRHGVD
EDQQLNLWLTTDNVRKGAALNAVQVAQLLIKHMP
Download sequence
Identical sequences V9UY08
WP_024086529.1.23948 WP_024086529.1.28354 WP_024086529.1.65739 gi|568180995|ref|YP_008953529.1| gi|568186426|ref|YP_008958958.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]