SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181007|ref|YP_008953541.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181007|ref|YP_008953541.1|
Domain Number 1 Region: 182-282
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000106
Family Multidrug resistance efflux transporter EmrE 0.048
Further Details:      
 
Domain Number 2 Region: 42-130
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000017
Family Multidrug resistance efflux transporter EmrE 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181007|ref|YP_008953541.1|
Sequence length 289
Comment transporter [Pseudomonas monteilii SB3078]
Sequence
MEKSTSGWINGFIGVAIFAGSLPATRVAVTAFEPTFLTCARATIAALLGALFLLVLRQPR
PERGDLWSLAVTALGVVIGFPLLTALALQHVTSAHSIVFVGLLPLCTAGFAVLRGGERPR
PLFWLFSLTGAGIVVGYALMNGGEASAQGDLLMMAAVIVCGLGYAEGARLSRTLGGWQVI
SWALLVALPLMLLLTITNLPTPDAFAKVSAPAWFSLGYVSLFSMLIGFVFWYRGLVQGGI
AAVGQLQLFQPFMGLGLAALLLHEQVSWMMLVVTLGAVICVAGAKKYAL
Download sequence
Identical sequences V9UZE4
gi|568186438|ref|YP_008958970.1| gi|568181007|ref|YP_008953541.1| WP_024086532.1.23948 WP_024086532.1.28354 WP_024086532.1.65739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]