SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181012|ref|YP_008953546.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181012|ref|YP_008953546.1|
Domain Number 1 Region: 5-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.24e-113
Family FMN-linked oxidoreductases 0.0000000028
Further Details:      
 
Domain Number 2 Region: 336-524
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.24e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000809
Further Details:      
 
Domain Number 3 Region: 473-633
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000446
Family C-terminal domain of adrenodoxin reductase-like 0.0000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568181012|ref|YP_008953546.1|
Sequence length 678
Comment 2,4-dienoyl-CoA reductase [Pseudomonas monteilii SB3078]
Sequence
MAADRYPHLLAPLDLGFTTLRNRTLMGSMHTGLEERPGGFERMAAYFAERARGGVGLMVT
GGIAPNDEGGVYSGAAKLSTEEEADKHRIVTEAVHAAGGKICLQILHAGRYAYSPRQVAP
SAIQAPINPFKPKELDEAGIEKQIADFVNCAVLAQRAGYDGVEIMGSEGYFINQFLAAHT
NHRTDRWGGSYENRMRLAVEIVSRVRGAVGPNFIIIFRLSMLDLIEGGSTWDEIELLAKA
IEKAGATLINTGIGWHEARIPTIATKVPRAAFSKVTAKLRGVVNIPLITTNRINTPEVAE
AVLAEGDADMVSMARPFLADPDFVNKAAAGRGDEINTCIGCNQACLDHTFGGKLTSCLVN
PRACHETELNYLPVRTVKRIAVVGAGPAGLAAATVAAERGHAVTLFDAASEIGGQFNVAK
RVPGKEEFHETLRYFRNKVKSTGVDLRLNTRVNVQALVDGGYDEIILATGIAPRTPAIPG
VEHAKVLSYLDVLLERKPVGKAVAVIGAGGIGFDVSEYLVHQGVATSQDREAFWKEWGID
THLQARGGVAGIKAEPHAPARQVYLLQRKKSKVGDGLGKTTGWIHRTGLKNKRVQMLNSV
EYLGIDDAGLHIRVADGEPQVLAVDNVVICAGQEPLRELQDGLVAAGQSVHLIGGADVAA
ELDAKRAINQGSRLAAEL
Download sequence
Identical sequences A0A059UTQ9 A0A0B5KL34 V9UZF0
gi|568181012|ref|YP_008953546.1| gi|568186443|ref|YP_008958975.1| WP_024086536.1.23948 WP_024086536.1.28354 WP_024086536.1.35335 WP_024086536.1.65739 WP_024086536.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]