SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181021|ref|YP_008953555.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181021|ref|YP_008953555.1|
Domain Number 1 Region: 211-456
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.11e-78
Family Leukotriene A4 hydrolase catalytic domain 0.0015
Further Details:      
 
Domain Number 2 Region: 4-199
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.96e-44
Family Leukotriene A4 hydrolase N-terminal domain 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|568181021|ref|YP_008953555.1|
Domain Number - Region: 650-767
Classification Level Classification E-value
Superfamily ARM repeat 0.0734
Family GUN4-associated domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568181021|ref|YP_008953555.1|
Sequence length 885
Comment aminopeptidase N [Pseudomonas monteilii SB3078]
Sequence
MRTEQPQVIYLKDYQAPEYLIDETHLTFELFEDHTLVHAQLVMRRNPARGAGLPPLVLDG
QQLELLRASLDDQELQPGDYQLDADSLTVQPKAEHFTLDTSVKIHPESNTALEGLYKSGK
MFCTQCEAEGFRKITYYLDRPDVMSTFTTTVIAEQHRYPVLLSNGNPIGSGPADDGRHWA
TWEDPFMKPAYLFALVAGDLWCVEDSFTRQSGRDVTLRIYVEPENIDKCDHAMVSLKKSM
RWDEEVYGREYDLDIFMIVAVNDFNMGAMENKGLNIFNSSCVLARAETATDAAHQRVEGV
VAHEYFHNWSGNRVTCRDWFQLSLKEGFTVFRDAEFSADMNSRTVKRIEDVAYLRTHQFA
EDAGPMAHPVRPDSFIEISNFYTLTVYEKGAEVVRMVRTLLGADGFRKGSDLYFERHDGQ
AVTTDDFIKAMEDANGVDFTQFKRWYNQAGTPRLEVSEAYDAAAQTYSLTFRQSCPQTPD
KAEKLPFVIPVELGLLDAAGNDLPLQLAGEDTAQGTSRVLSVTEAEQTFTFQGIQAKPLP
SLLRGFSAPVKLSFPYDRDQLMFLMQHDSDGFNRWEAGQQLSVQVLQELIGQHQRGEALK
LDQRLITALGTVLGNESLDPAMVAEMLSLPGEAYLTEISQVADVDAIHAAREFARQQIAE
QLFDALWARYQANREVSRSTAYVASAEHFARRSLQNIALSYLMQSGKPQVLQAALEQFEH
CDNMTERLTALAVLVNSPFEAERAKALEAFAEHFKDNPLVMDQWFSVQAASTLPGGLARV
KALMQHPAFTLKNPNKVRALIGAFAGQNLVNFHAADGSGYRFLADLVIELNALNPQIASR
QLAPLTRWRKYDDARQALMKGELERILASGELSSDVYEVVSKSLA
Download sequence
Identical sequences A0A0B5KL23 V7D799 V9UUQ9
WP_023662336.1.23948 WP_023662336.1.28354 WP_023662336.1.65739 WP_023662336.1.80759 gi|568181021|ref|YP_008953555.1| gi|568186452|ref|YP_008958984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]