SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181047|ref|YP_008953583.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181047|ref|YP_008953583.1|
Domain Number 1 Region: 152-284
Classification Level Classification E-value
Superfamily PR-1-like 1.96e-22
Family PR-1-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568181047|ref|YP_008953583.1|
Sequence length 286
Comment Allergen V5/Tpx-1 family protein [Pseudomonas monteilii SB3078]
Sequence
MRHAVRRSPFVSLCLIPFFHLFANPAHASGERQLVAAINDYRTQPQRCERRIIRGSTPLV
LKPKLALPVGYGGGLREGLKAAGYQAVKVRAIRLVGAQDAEEAFDMLRSDYCTALLDSQY
ADIGVSRSRNEWRVLLARPLLDAQLGDGRSASKALLAQVNAARAKPRLCGRKRFAAARPL
AWNTALGTAAQRHSRAMANDNFFAHRDLDGDLPADRAWDAGYRGRQIGENIAAGQGSPSK
AMAGWLASPGHCANLMNPMFTQVGAAFAENSRSDNGVYWTMLFGAP
Download sequence
Identical sequences A0A059UR23 F8FTC1 V7D3H9 V9UZI9
2035966456 gi|568186478|ref|YP_008959012.1| WP_013971651.1.23948 WP_013971651.1.28354 WP_013971651.1.35335 WP_013971651.1.56258 WP_013971651.1.65739 WP_013971651.1.7288 WP_013971651.1.80759 gi|339486555|ref|YP_004701083.1| gi|568181047|ref|YP_008953583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]