SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181076|ref|YP_008953612.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181076|ref|YP_008953612.1|
Domain Number 1 Region: 1-335
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.6e-104
Family FMN-linked oxidoreductases 0.00000000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568181076|ref|YP_008953612.1|
Sequence length 341
Comment dihydroorotate dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MYTLARQLLFKLSPETSHDLSLDLIGAGGRLGLNGMLCKQPAALPVTVMGLNFANPVGLA
AGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRLFRLPEATAIINRMGFNNLGVD
HLLGRVRAARYNGVLGINIGKNFDTPVERAVDDYLICLDKVYTEASYITVNVSSPNTPGL
RSLQFGDSLKQLLDALAVRREQLAGTHGKRVPLAIKIAPDMSDEETALVAAALMESGMDA
VIATNTTLGREGVEGLPYGGEAGGLSGAPVLEKSTHIVKVLAGELGGKLPIIAAGGITEG
RHAAEKIAAGASLVQIYSGFIYKGPALIREAVDAIAAMPRV
Download sequence
Identical sequences A0A059UZE5 V9UUV9
gi|568186507|ref|YP_008959041.1| WP_024086563.1.23948 WP_024086563.1.28354 WP_024086563.1.35335 gi|568181076|ref|YP_008953612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]