SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181080|ref|YP_008953616.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181080|ref|YP_008953616.1|
Domain Number 1 Region: 36-475
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 6.54e-90
Family Dac-like 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568181080|ref|YP_008953616.1|
Sequence length 485
Comment D-alanyl-D-alanine carboxypeptidase [Pseudomonas monteilii SB3078]
Sequence
MIKTLRPLVLAGLLLPLALPSQAAAVNTTLPAKVQQALKANKLQDSALSLVMLPLDGPGT
PTVFNADVSVNPASTMKLVTTYAALELLGPTFQWKTEFYTDGTLSNGVLNGNLYLKGGGD
PKLNMEKLWLLMRDLRANGVRTITGDLVLDRSHFVQPNLPQFNDDGGDENKPFLVKPDSL
LVNLKALRFVARNDGGKVTIAVEPPIASIRIDNQVKAVASRQCSGDVRYNPVQQADGISV
TVSGQLGDGCNSQTYLSLLDHQTYAAGAVRAIWNELGGSIQGGDRFENVPKGARLLARAF
SPDLVEVIRDINKYSNNTMAQQLFLSLGAQFRTDADGDDARAAQRVVRQWLAKKGITAPH
LVMENGSGLSRAERVSTREMAAMLQAAWKSPYAAEFMSSMPLVGMDGTMRKRLKRTAMTG
EGHIKTGTLNTVRAIAGFSRDSNGHTWAVAAILNDPKPWGASQVLDQVLLDLYRQPKLAG
STAAN
Download sequence
Identical sequences A0A059UR33 A0A099MVZ5 A0A0C1HRM5 F8FTF3 V7DD75 V9UY89
gi|568181080|ref|YP_008953616.1| WP_013971678.1.1643 WP_013971678.1.23948 WP_013971678.1.28354 WP_013971678.1.35335 WP_013971678.1.56258 WP_013971678.1.65739 WP_013971678.1.7288 WP_013971678.1.7435 WP_013971678.1.80759 gi|339486587|ref|YP_004701115.1| gi|568186511|ref|YP_008959045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]