SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181126|ref|YP_008953663.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181126|ref|YP_008953663.1|
Domain Number 1 Region: 81-208
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 1.33e-40
Family Tetracyclin repressor-like, C-terminal domain 0.000000792
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily Homeodomain-like 3.49e-18
Family Tetracyclin repressor-like, N-terminal domain 0.0000514
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568181126|ref|YP_008953663.1|
Sequence length 237
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MAQSETVERILDAAEQLFAERGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRF
LGPFCASLERELERRQAKPEHKPSLEELLEMLVEQALAVQPRSNNDLSIFMRLLGLAFSQ
SQGHLRRYLEDMYGKVFRRYMLLVNEAAPRIPPLELFWRVHFMLGAAAFSMSGIKALRAI
AETDFGINTSIEQVMRLMVPFLAAGMRADSGITDDAMAAAQLRPRTKTSAGATTAKA
Download sequence
Identical sequences V9UV14
gi|568186557|ref|YP_008959092.1| WP_024086580.1.23948 WP_024086580.1.28354 gi|568181126|ref|YP_008953663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]