SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181133|ref|YP_008953670.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181133|ref|YP_008953670.1|
Domain Number 1 Region: 293-456
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 4.46e-55
Family GAPDH-like 0.0000181
Further Details:      
 
Domain Number 2 Region: 133-309
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.4e-44
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181133|ref|YP_008953670.1|
Sequence length 482
Comment glyceraldehyde-3-phosphate dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MTQKPDQCLGEWIDREALAEAMIPLIGQLYRNNNVVSSIYGRSLINRSVISILKAHRFAR
HRQADETELSVHETFPLLKAMSELKLGAASVDLGKLANKFKQEGNGRTAEQFVREELAEV
VGQQNASARKGTDVVLYGFGRIGRLLARILIEKTGGGDGLRLRAIVVRKGAENDLVKRAS
LLRRDSVHGPFDGTITIDEANNTITANGNLIQVIYAKSPSEVDYTQYGIENALIVDNTGV
WRDADGLGQHLACPGAARVILTAPGKGALKNIVHGINHGDIAADDKIISAASCTTNAIVP
VLKAINDQYGIVNGHVETVHSFTNDQNLIDNFHKGSRRGRAAPLNMVITETGAATAAAKA
LPVLKGKLTGNAIRVPTPNVSMAILNLNLEKATSRDEINEYLRQTAMHSELHKQIDYVSS
QEVVSTDFVGSRHAGVVDAEATICNDNRVVLYVWYDNEFGYSCQVVRVMEEMAGVNPPAF
PH
Download sequence
Identical sequences A0A059UVC7 A0A0B5KEH8 F8FUQ6 V7DEK9 V9UWN1 V9WRF6
gi|339486639|ref|YP_004701167.1| gi|568181133|ref|YP_008953670.1| gi|568186564|ref|YP_008959099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]