SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181214|ref|YP_008953752.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181214|ref|YP_008953752.1|
Domain Number 1 Region: 52-151
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000275
Family Multidrug resistance efflux transporter EmrE 0.0093
Further Details:      
 
Domain Number 2 Region: 199-291
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000379
Family Multidrug resistance efflux transporter EmrE 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568181214|ref|YP_008953752.1|
Sequence length 316
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MSQPSSKPTPAITFRLSKAELVLVFITMLWGGTFLLVHNVMSVSGPMFFVGLRFAAAALF
VGVVSARALPGLTFTELKAGMLIGVSIMLGYGLQTMGLQTISSSQSAFITALYVPFVPLL
QWLVLGRRPGLMPSIGIGLAFIGLMLLAGPEGGSLHFSEGELVTLVSAVAIAGEIILISR
YAGQVDVRRVTVVQLATASLLAFLMIVPTQERIPDFSWLLLTSAVGLGAMSAVIQVAMNW
AQKSVSPTRATLIYAGEPVWAGIVGRIAGERLPGVALLGGLLIVIAVVVSELKVRRPREV
AEAQEVQDEGERQAGL
Download sequence
Identical sequences V7D6U3 V9UXN3
gi|568181214|ref|YP_008953752.1| gi|568186645|ref|YP_008959181.1| WP_023662797.1.23948 WP_023662797.1.28354 WP_023662797.1.35335 WP_023662797.1.56258 WP_023662797.1.7288 WP_023662797.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]