SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181223|ref|YP_008953761.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181223|ref|YP_008953761.1|
Domain Number 1 Region: 185-282
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000036
Family Multidrug resistance efflux transporter EmrE 0.026
Further Details:      
 
Domain Number 2 Region: 47-140
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000144
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181223|ref|YP_008953761.1|
Sequence length 295
Comment threonine transporter RhtB [Pseudomonas monteilii SB3078]
Sequence
MNTQPRSLAATLFPIGLLLIAMASIQSGASLAKSMFPLIGAQGTTTLRLIFASIIMLLIL
RPWRVRMTRNTLRNVIIYGMALGGMNFLFYMALQTVPIGIAVALEFTGPLAVAIFSSRRP
IDFLWIALAIVGLLLLLPAGHGGQALDPVGAAYALGAGVCWALYILFGQRAGAEHGIQSA
ALGVVVAALFVAPIGIAHAGSALLTPALIPMALGVAVLSTALPYSLEMVALTRIPARTFG
TLMSIEPAFGALSGLLFLGEVLTITQWLAILAIITASVGTTLSMRKEPSPVVATD
Download sequence
Identical sequences F8FXC9 V9UWZ3
gi|339486770|ref|YP_004701298.1| gi|568186654|ref|YP_008959190.1| WP_013971850.1.23948 WP_013971850.1.28354 WP_013971850.1.56258 WP_013971850.1.65739 WP_013971850.1.7288 gi|568181223|ref|YP_008953761.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]