SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|568181314|ref|YP_008953859.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181314|ref|YP_008953859.1|
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily Rv1873-like 7.98e-59
Family Rv1873-like 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181314|ref|YP_008953859.1|
Sequence length 141
Comment calpastatin [Pseudomonas monteilii SB3078]
Sequence
MHADFDLQRFVEAQNPVYDQVMQELQAGRKRSHWMWYVFPQLDGLGHSAMAERYALAGID
EARAYLAHPLLGPRLQACVTALLQHHDKSAREMLGSPDYLKLRSCLTLFAQAAPGNPLFQ
LALVQFYDGEPDALTLAMLQG
Download sequence
Identical sequences A0A059V012 A0A099MWZ0 A0A136QMS8 F8FYR3 J8S0X1 V7D9R6 V9UXX6
WP_003256418.1.1643 WP_003256418.1.23948 WP_003256418.1.28354 WP_003256418.1.35335 WP_003256418.1.56258 WP_003256418.1.57632 WP_003256418.1.65739 WP_003256418.1.7288 WP_003256418.1.80759 WP_003256418.1.95946 2035940778 gi|339486854|ref|YP_004701382.1| gi|568181314|ref|YP_008953859.1| gi|568186745|ref|YP_008959288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]