SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181335|ref|YP_008953880.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181335|ref|YP_008953880.1|
Domain Number 1 Region: 2-257
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 2.1e-81
Family Aldo-keto reductases (NADP) 0.00000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568181335|ref|YP_008953880.1|
Sequence length 267
Comment 2,5-diketo-D-gluconic acid reductase [Pseudomonas monteilii SB3078]
Sequence
MSVPSFGLGTFRLTGQAVIDSVKSALELGYRVIDTAQIYKNEADVGQAIAESGVKRGELF
ITTKIWVENYAADKLVPSLRDSLQKLRTDYVDLLLIHWPAPGNGVALPEYMAALAEAKKL
GLARQIGVSNFNIELTRQAIEVVGEGEIATNQIELSPYLQNSKLTAFLKEQGVTVTSYMT
LAYGKVLKDPVLADIAAKHKATVAQVALAWALQLGYAVIPSSTKRENLASNLLARDLKLD
ADDMARIAKLERNGREVSPDGLAPIWD
Download sequence
Identical sequences A0A059UVX0 A0A099MZ66 V7D931 V9UZ05
WP_023662335.1.23948 WP_023662335.1.28354 WP_023662335.1.35335 WP_023662335.1.65739 WP_023662335.1.7288 WP_023662335.1.80759 gi|568186766|ref|YP_008959309.1| gi|568181335|ref|YP_008953880.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]