SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181348|ref|YP_008953893.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181348|ref|YP_008953893.1|
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 6.67e-20
Family Bacterial S-adenosylmethionine decarboxylase 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568181348|ref|YP_008953893.1|
Sequence length 129
Comment S-adenosylmethionine decarboxylase [Pseudomonas monteilii SB3078]
Sequence
MDDRGYHTIWDITGASAKLLSNDRKLHRFFLTALQASGFNIISDMIHKFSSGGEGVTGIF
LLSESHLSYHTYPEREYISIDVYTCGKNNDLINDRILGFFGADVQVNKRTLLRGSAVADR
LGGEHAVAR
Download sequence
Identical sequences A0A2A3M419 F8FYU6 V9UX99
gi|568186779|ref|YP_008959322.1| gi|568181348|ref|YP_008953893.1| WP_013971951.1.23948 WP_013971951.1.28354 WP_013971951.1.35335 WP_013971951.1.56258 WP_013971951.1.65739 WP_013971951.1.7288 gi|339486887|ref|YP_004701415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]