SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181439|ref|YP_008953991.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568181439|ref|YP_008953991.1|
Domain Number - Region: 34-106
Classification Level Classification E-value
Superfamily Tropomyosin 0.0024
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181439|ref|YP_008953991.1|
Sequence length 176
Comment hypothetical protein X969_08305 [Pseudomonas monteilii SB3078]
Sequence
MNWLGAVPAWCWWLIALVLVAGGQQYRVVVAQGEAVSARAELADYRLQVAERDRRAAAQA
RAEEQRRQSVADEEGESARKKLELAKGRAATAESAADGLRGEIARLLEGHRATCDTIAAQ
QRQAGTSAVVVLGRLLEEADRMAGDLATALERSRIAGLACEAVNDGVRDKRLGDQF
Download sequence
Identical sequences WP_024086722.1.23948 gi|568181439|ref|YP_008953991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]