SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181512|ref|YP_008954066.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181512|ref|YP_008954066.1|
Domain Number 1 Region: 1-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.35e-117
Family FMN-linked oxidoreductases 0.0000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181512|ref|YP_008954066.1|
Sequence length 368
Comment N-ethylmaleimide reductase [Pseudomonas monteilii SB3078]
Sequence
MPQDPLFQPLQFGALNLPNRVLMPPMTRSRAAQPGDVPTALMAEYYAQRASAGLIVSEGT
WISPLGKGYARTPGIHTQAQIDGWRLVTEAVHAAGGRIFAQLWHVGRLSHSSLLGGQAPV
SSSAMQAEGVNVFIDNADGTPGFVQASKPRALSEAEIAEIIEQYRQAARNAMAAGFDGVE
LHAANGYLVNQFLDSGANDRTDRFGGSLENRLRFLDLVTRALVEGTGDAQRVGVRLAPLT
TLNGCVDADPVTTYTAAAKCLGVIGIGYLHIAEADWDDAPDMPVDFKQQLRAVFPGVMVY
AGKYTGERARRALEEGWADLVGFGRPFVANPDLPARLKLNAPLAEHERATLFGGDAHGLT
DYPPLATA
Download sequence
Identical sequences V9UZC5
WP_024086764.1.23948 WP_024086764.1.28354 WP_024086764.1.7288 gi|568186891|ref|YP_008959436.1| gi|568181512|ref|YP_008954066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]