SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181577|ref|YP_008954134.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181577|ref|YP_008954134.1|
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.9e-45
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0092
Further Details:      
 
Domain Number 2 Region: 126-318
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 6.05e-30
Family Glucose 6-phosphate dehydrogenase-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181577|ref|YP_008954134.1|
Sequence length 350
Comment oxidoreductase [Pseudomonas monteilii SB3078]
Sequence
MNAPLRIALIGAGSMGRQHYQHLLNVPQAQLCAVADPGPQAEAFAAECGVPCFADHRQML
EHARPEAVIVANPNNLHVATALDCVEAGVPVLVEKPVGVHLDEVRALVEASRRHDVPVLV
GHHRRHNPLIAKAHQVIADGKLGRLINVTALWQLQKPDSYFDTPWRREPGAGFLLTNLIH
DLDLLRHLCGEVVQVQAFTRNDVRGFANEDSAAVLLQFANGALGSLTGSDAVAAPWSWEL
DSGESPVYPRQDGQPCYLLAGTQGALSIPQLKRWHYAEAGAGWHTPLLQSEESIPAGEAL
TLQLQHFVQVARGEQAPLIDAADGGRTLALIEAIRQAAETGRACAPEHIA
Download sequence
Identical sequences V9UZJ1
gi|568186956|ref|YP_008959504.1| gi|568181577|ref|YP_008954134.1| WP_024086797.1.23948 WP_024086797.1.28354 WP_024086797.1.56258 WP_024086797.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]