SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181707|ref|YP_008954270.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181707|ref|YP_008954270.1|
Domain Number 1 Region: 152-314
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 7.44e-65
Family GAPDH-like 0.00000116
Further Details:      
 
Domain Number 2 Region: 3-171
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.05e-52
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181707|ref|YP_008954270.1|
Sequence length 334
Comment glyceraldehyde-3-phosphate dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MAIKVGINGFGRIGRLALRASWGWPEFEFVQINDPAGDAETHAHLINFDSVHGRWDREAG
ADGDSVVIEGKRIKVTANKTIADTDWSGCDLVIEASGKMKSVAVLQAYLDQGVKRVVVCA
PVKEKGALNVVMGVNQHLFDPTQHRIVTAASCTTNCLAPVIKVIHENLGIRHGSITTIHD
LTNTQSILDTPHKDLRRARASGMSLIPTTTGSATAIAEIFPELRGKLNGHAVRVPLANAS
LTDCVFEVARETTAEEVNALLKAAAEGPLKGILGYEQRPLVSIDYRTDPRSSIIDALSTL
VVNGTQVKIYAWYDNEWGYANRAAELARMVGTAE
Download sequence
Identical sequences A0A059V0J5 F8G3Y0 V9UWL9
gi|568181707|ref|YP_008954270.1| gi|339487191|ref|YP_004701719.1| gi|568187087|ref|YP_008959641.1| WP_013972224.1.23948 WP_013972224.1.28354 WP_013972224.1.35335 WP_013972224.1.56258 WP_013972224.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]