SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181774|ref|YP_008954339.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568181774|ref|YP_008954339.1|
Domain Number - Region: 26-80
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181774|ref|YP_008954339.1|
Sequence length 84
Comment hypothetical protein X969_10090 [Pseudomonas monteilii SB3078]
Sequence
MQRYLLAGLSSLLLASASGCTPWHAEEYDARLESAENNAATARLRADQVCYRIDLVEQTA
NEALRRATQAQEQVQQLLQQAKRK
Download sequence
Identical sequences A0A0C1I1M2 A0A0M2ULZ9 A0A0P7D2L0 A0A177KWF6 A0A1W2D0J0 A0A212RTL1 A0A285YHW4 A0A2A3M501 V9UYF3
WP_024086880.1.1090 WP_024086880.1.1643 WP_024086880.1.19681 WP_024086880.1.23948 WP_024086880.1.28354 WP_024086880.1.35335 WP_024086880.1.42506 WP_024086880.1.54338 WP_024086880.1.59535 WP_024086880.1.62279 WP_024086880.1.65739 WP_024086880.1.66713 WP_024086880.1.67665 WP_024086880.1.71479 WP_024086880.1.7288 WP_024086880.1.7435 WP_024086880.1.75010 WP_024086880.1.80759 WP_024086880.1.93113 WP_024086880.1.98117 WP_024086880.1.98215 gi|568187154|ref|YP_008959710.1| gi|568181774|ref|YP_008954339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]