SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181841|ref|YP_008954409.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181841|ref|YP_008954409.1|
Domain Number 1 Region: 1-217
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.72e-61
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000622
Further Details:      
 
Domain Number 2 Region: 222-322
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 7.46e-29
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568181841|ref|YP_008954409.1|
Sequence length 333
Comment FAD-binding molybdopterin dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MTPFSYHKPASVSEAVNLADACSHFIAGGTNLVDLMKENVVRPQRLIDISGLGLNGIHST
RNGGVLIGARVSNADLAWHPMIEQHYPLLSDAILAGASPQLRNMASTGGNLLQRTRCYYF
YDTGTPCNKREPGSGCPARTGMNRIHAILGGSDACVATHPSDMCVALAALEAVVHLEGPS
GKRQIPFADFHRLPGDTPERDNQLAVAELVTGIELPPPVFEHHYRYLKIRDRASYAFALV
SVAAALNFDGEVIQQARLALGGVAHKPWRDPVVERMLAGQVPCEALFTRAAQTLLQGAQP
LSHNGFKVTLAQRAIVRALDDAARGAADRGPRP
Download sequence
Identical sequences A0A1Y5KZL0 I7BPZ4 V9V0B9
WP_014859176.1.23948 WP_014859176.1.28354 WP_014859176.1.33269 WP_014859176.1.5613 WP_014859176.1.78345 gi|568187221|ref|YP_008959780.1| gi|397693078|ref|YP_006530958.1| gi|568181841|ref|YP_008954409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]