SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181904|ref|YP_008954475.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181904|ref|YP_008954475.1|
Domain Number 1 Region: 8-89
Classification Level Classification E-value
Superfamily Homeodomain-like 8.72e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 91-194
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000116
Family Tetracyclin repressor-like, C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568181904|ref|YP_008954475.1|
Sequence length 206
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MVIMSPKRRTQAERAMETQGKLIAAALGVLREKGYAGFRIADVPGAAGVSRGAQSHHFPT
KLELLLATFEWLYEQITERSRARLAKLKPEDDVIQQMLDDAAEFFLDDDFSISLDLIVAA
DRDPALREGIQRTVERNRFVVEDMWLGVLVSRGLSRDDAEDILWLIFNSVRGLAVRSLWQ
KDKERFERVRNSTLEIARERYAKFKR
Download sequence
Identical sequences A5W4H8 E0X995 V9UYR1
gi|568187284|ref|YP_008959845.1| 351746.Pput_2908 gi|568181904|ref|YP_008954475.1| WP_012052627.1.1079 WP_012052627.1.23948 WP_012052627.1.28354 WP_012052627.1.33269 WP_012052627.1.35996 WP_012052627.1.5613 WP_012052627.1.78345 gi|148548120|ref|YP_001268222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]