SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181920|ref|YP_008954492.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181920|ref|YP_008954492.1|
Domain Number 1 Region: 8-86
Classification Level Classification E-value
Superfamily Homeodomain-like 3.54e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0088
Further Details:      
 
Weak hits

Sequence:  gi|568181920|ref|YP_008954492.1|
Domain Number - Region: 90-191
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0667
Family Tetracyclin repressor-like, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568181920|ref|YP_008954492.1|
Sequence length 207
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MAKYPAQRRTQAERREETRSRIIEAAISELLHNGYAGIRVDKVAIAAKVSRGAQSHHFPT
KESLVLAALETLYQASTEVSMKVIDNLASEDVLDALMQESAKFYLGPNFTIAMSLLNLGD
SNPELRKKVRIMARKYRLPIEKAWLDALTRSGLDEEPARTVLSITQSVYRGMTTRRFLRN
DPEYASFTFEQWSKIARAFMNQHSLKR
Download sequence
Identical sequences A5W4G2 I7BEI1 Q3LWT5 V9UZI6
gi|397696994|ref|YP_006534877.1| 351746.Pput_2892 gi|568187300|ref|YP_008959862.1| gi|148548104|ref|YP_001268206.1| gi|568181920|ref|YP_008954492.1| WP_012052611.1.1079 WP_012052611.1.23948 WP_012052611.1.28354 WP_012052611.1.33269 WP_012052611.1.35996 WP_012052611.1.5613 WP_012052611.1.78345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]