SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181923|ref|YP_008954495.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181923|ref|YP_008954495.1|
Domain Number 1 Region: 133-286
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.7e-63
Family GAPDH-like 0.00000224
Further Details:      
 
Domain Number 2 Region: 8-157
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 7.3e-27
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568181923|ref|YP_008954495.1|
Sequence length 314
Comment acetaldehyde dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MQTHDGKTAVAIIGSGNIGTDLMVKILRHGKHLRMGAFVGIDPESDGLKRAERMGVPTVS
TGIEGLLSHPDFGSIGFVFDATSAGAHARHEQLLRPHGVRVIDLTPAAIGPFVVPAVNIE
QHLDAPNVNMVTCGGQATIPMVAAVSRVVPVEYAEIVASISSRSAGPGTRANIDEFTETT
SNAIVRVGGAQRGKAIIILNPAEPPLIMRDTVYCLVPGHADRQAIVESVERMASAVAAYV
PGYRLKQTVQFDEFKGRMPQETGSAQAPRLKVSVFLEVEGAGHYLPSYAGNLDIMTSAAL
ATAERIAARQPVAA
Download sequence
Identical sequences A5W4F9 I7CA81 Q51982 V9V1X5
WP_012052608.1.1079 WP_012052608.1.23948 WP_012052608.1.28354 WP_012052608.1.33269 WP_012052608.1.35996 WP_012052608.1.5613 WP_012052608.1.78345 gi|148548101|ref|YP_001268203.1| gi|568187303|ref|YP_008959865.1| gi|397696997|ref|YP_006534880.1| 351746.Pput_2889 gi|568181923|ref|YP_008954495.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]