SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181936|ref|YP_008954510.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181936|ref|YP_008954510.1|
Domain Number 1 Region: 132-286
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.9e-65
Family GAPDH-like 0.00000057
Further Details:      
 
Domain Number 2 Region: 1-156
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.27e-29
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.00000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568181936|ref|YP_008954510.1|
Sequence length 316
Comment acetaldehyde dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MTRKVKAAIIGSGNIGTDLMIKILRHGQHIEMGAMVGIDPASDGLARAQRMGVAITHEGV
EGLTRLPVFNEIDVVFDATSAGAHVKNEALLRERKPGLRMIDLTPAAIGPYCIPVVNGDD
HLDATNVNMVTCGGQATIPMVAAVSRVAKVHYAEIIASISSKSAGPGTRANIDEFTETTS
KAIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYTLSDFADIDQIEESVQRMADAVQAYVPG
YRLKQRVQFDRIEADCPIRIPGVGDRMNGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAAL
RTAEKLAERLLASLVA
Download sequence
Identical sequences A5W4E5 I7C122 Q9EVJ2 V9V0K3
gi|397697013|ref|YP_006534896.1| gi|568187316|ref|YP_008959880.1| gi|568181936|ref|YP_008954510.1| 351746.Pput_2874 gi|148548087|ref|YP_001268189.1| WP_012052594.1.1079 WP_012052594.1.23948 WP_012052594.1.28354 WP_012052594.1.35996 WP_012052594.1.5613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]