SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568181980|ref|YP_008954574.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568181980|ref|YP_008954574.1|
Domain Number 1 Region: 31-151
Classification Level Classification E-value
Superfamily OMPA-like 0.00000392
Family Outer membrane protein 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568181980|ref|YP_008954574.1|
Sequence length 169
Comment aldehyde dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MKTVLAAAALSLFAASAGAAELSGALGATSQGGITARAGVGFNWDKSWFESSTGRLTGYW
DAGYTYWEAGDASGGAHSLSFAPVFVYEFGSGNVKPFVEAGIGLAVFSGTSAGDQDFGSA
FNFEDRIGAGLKIGETQKVGIRAIHYSNAGIKQPNDGIESYSLFYSHQI
Download sequence
Identical sequences A0A0P7D7A4 A0A2A3LVQ0 A0A2H4J0I5 V7DDI7 V9V0P4
WP_023661594.1.10502 WP_023661594.1.23948 WP_023661594.1.28354 WP_023661594.1.28475 WP_023661594.1.54338 WP_023661594.1.65739 WP_023661594.1.83952 WP_023661594.1.9999 gi|568181980|ref|YP_008954574.1| gi|568187361|ref|YP_008959945.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]