SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182055|ref|YP_008954663.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182055|ref|YP_008954663.1|
Domain Number 1 Region: 183-283
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000889
Family Multidrug resistance efflux transporter EmrE 0.013
Further Details:      
 
Domain Number 2 Region: 40-132
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000366
Family Multidrug resistance efflux transporter EmrE 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182055|ref|YP_008954663.1|
Sequence length 294
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MPLKDLLIALVVIVAWGVNFVVIKVGLDGLPPMLLGALRFLLVAFPAILLVKRPKLPWRW
LIAYGATISLGQFAFLFQAMYSGMPPGLASLILQSQAFFTLGFAALFLGERLRLASVLGL
LVAASGLALIGSEDGGHVPMLALVLTLCAGAMWGMGNIITRRFGSVDLVALVIWGGLIPP
LPFLALSWWLEGPERIGHAIANISWSSVLALAYLAFVATMLGYSLWSKLLSRHPAGKVAP
FSLLVPVIGLSSSALLLGERLTATQGWGALLVMAGLLVNVFGARLGRRLRAVSA
Download sequence
Identical sequences A0A059V138 A0A099N1A5 A0A136QP46 V7D4N2 V9UZV6
WP_023663280.1.1643 WP_023663280.1.23948 WP_023663280.1.28354 WP_023663280.1.35335 WP_023663280.1.56258 WP_023663280.1.57632 WP_023663280.1.65739 WP_023663280.1.7288 WP_023663280.1.80759 WP_023663280.1.95946 gi|568187435|ref|YP_008960033.1| gi|568182055|ref|YP_008954663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]