SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182063|ref|YP_008954671.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182063|ref|YP_008954671.1|
Domain Number 1 Region: 81-179
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.07e-22
Family Tetracyclin repressor-like, C-terminal domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000493
Family Tetracyclin repressor-like, N-terminal domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568182063|ref|YP_008954671.1|
Sequence length 187
Comment TetR family transcriptional regulator [Pseudomonas monteilii SB3078]
Sequence
MRYTNEHKQQTRERLLASSGALAKRGGFSSTGVAGLMKAIGLTGGAFYNHFPSKDDLFTE
VVRQELCNSPLARLTNQGASRERLGRCLQQYLSLAHLHNAEGGCPLPPLGVEIARAEAPV
RAVAEHWLLELHQAWSATLEDSELAWVLISQCVGALLVGRMLATESVQSQVLDASRHFVE
KALHEAD
Download sequence
Identical sequences A0A099MYR6 F8FSG7 V7D298 V9V2A4
gi|568182063|ref|YP_008954671.1| gi|339487457|ref|YP_004701985.1| WP_013972477.1.23948 WP_013972477.1.28354 WP_013972477.1.56258 WP_013972477.1.65739 WP_013972477.1.7288 WP_013972477.1.80759 gi|568187443|ref|YP_008960041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]