SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182077|ref|YP_008954685.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182077|ref|YP_008954685.1|
Domain Number 1 Region: 192-288
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000432
Family Multidrug resistance efflux transporter EmrE 0.013
Further Details:      
 
Domain Number 2 Region: 52-148
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000745
Family Multidrug resistance efflux transporter EmrE 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182077|ref|YP_008954685.1|
Sequence length 290
Comment membrane protein [Pseudomonas monteilii SB3078]
Sequence
MSTGTTTLTNPKARAWVWPALFSLVAFAANSVFCRLALKDGAIDPASFTVVRLASGALFL
LLLIRLRKPALAMGGSWRGGLALFLYAFLFSAAYLQLGAGAGALLLFGAVQITMFGFAWY
KGEQITARMLLGMLIAFVGLLVLLLPGTAAPPFASALLMALSGVAWGVYTLLGKGSPRPL
ADTAGNFTRSLPCLVLLAPMLMLGADLHLSPLGVLYALGSGVLASGAGYAVWYGVVRQVS
AQQAATMQLSVPVIAALGGVGLIGEPLSLRLLVACVVVLGGIALALASRR
Download sequence
Identical sequences V9UXN4
WP_024087035.1.23948 WP_024087035.1.28354 WP_024087035.1.56258 WP_024087035.1.65739 WP_024087035.1.7288 gi|568182077|ref|YP_008954685.1| gi|568187457|ref|YP_008960055.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]