SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182245|ref|YP_008954861.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182245|ref|YP_008954861.1|
Domain Number 1 Region: 9-257
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.82e-80
Family Crotonase-like 0.000000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182245|ref|YP_008954861.1|
Sequence length 257
Comment 2,3-dehydroadipyl-CoA hydratase [Pseudomonas monteilii SB3078]
Sequence
MPRYLDVQAPEQGVQLITLQRPEALNALCTELLAELAAALEAAGQDEQTRAVVITGSRKA
FAAGADIREMAERDLVGILNDPRVAHWQSIAAFAKPLIAAVNGYALGGGCELVMCADIVI
AGSDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAITAPHALQAGLVSEIT
QPELTVERALHIARGIAAKAPLAVRLAKEALLKAGDTDLASGLRFERHAFTLLAGTADRD
EGIRAFQEKRQARFQGR
Download sequence
Identical sequences A0A099MZ95 V7D504 V9V2T3
WP_023663238.1.23948 WP_023663238.1.28354 WP_023663238.1.65739 WP_023663238.1.7288 WP_023663238.1.80759 gi|568187623|ref|YP_008960229.1| gi|568182245|ref|YP_008954861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]