SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182262|ref|YP_008954879.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182262|ref|YP_008954879.1|
Domain Number 1 Region: 302-499
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.34e-54
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 23-207
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.01e-51
Family Methylesterase CheB, C-terminal domain 0.00051
Further Details:      
 
Domain Number 3 Region: 946-1116
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-40
Family Histidine kinase 0.0021
Further Details:      
 
Domain Number 4 Region: 1134-1255
Classification Level Classification E-value
Superfamily CheY-like 2.28e-30
Family CheY-related 0.0061
Further Details:      
 
Domain Number 5 Region: 875-958
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000124
Family Homodimeric domain of signal transducing histidine kinase 0.0026
Further Details:      
 
Domain Number 6 Region: 233-304
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000101
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0069
Further Details:      
 
Domain Number 7 Region: 740-860
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000175
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.058
Further Details:      
 
Weak hits

Sequence:  gi|568182262|ref|YP_008954879.1|
Domain Number - Region: 674-744
Classification Level Classification E-value
Superfamily Tropomyosin 0.0131
Family Tropomyosin 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182262|ref|YP_008954879.1|
Sequence length 1260
Comment chemotaxis protein [Pseudomonas monteilii SB3078]
Sequence
MKSSPKQPASPQNPALSPSHLDFPVVGIGASAGGLEAICTLFRQMPSDCGMAFVVVLHLS
PDHQSVADRIIQETTQMPVRQVTEPVPIERNHIYVISPANRLSTNDGYLRVTPANRRRGD
HVAIDLFFRDLADVHKDHAFCVVLSGTGADGAVGLSRIKEQGGVTLAQTPDDAQYDSMPR
AAIETGMVDLVLPAAEMPQKLLELWRNARQVRLPEIEDDTLPPALGTRVGDAQASEPMLE
EILLQLRSNTGHDFQHYKRATVLRRIERRLHVTGQADLAAYLHYLEQHPAESRALLADML
IGVTNFFRDREAFEALERHVLPQLVCERDPAEGADEIRVWSAGCSTGEEAYSLAMLVCEQ
LALEQRSHKVQVFATDLDERAIGIARSGSYPEAIVTDVPPIRLRQFFLKEDQHYRVRKEV
REKVLFARHNLLSDPPFSQIDLIVCRNLLIYLDREVQRDILQMFHFALRPGGYLFLGSSE
SADVANELFAPVDKRNRIFRALDASNTGRRSGRQLPGTSAAGRPQEALAKAKPGRKPSFA
DLHYRALARRMPPSLIVDIDGNILHMSEGVGRFLQVAGGEPSRSLLNLVLPPLRLALRST
LFQARQGTEAVTSRPVDLAETMGKLQVEITVQPYRDDLSGSDCLLVVFEERAPDPSLPMP
GVIRQTDSMVLHNLERELQRTRLQLQETIEQSEVSSEELTASNEEMQAINEELRSASEEL
ETSKEELQSINEELLTVNYELKNKVEETDKVNDYLSNLIACTEIATVFVDRNLHIRWFTP
RATDLFNMLPVDTGRSLLDITHRLDYPALADDARAVAQGEAIIEREIGGQGDHWYLARLL
PYRSSEQKIDGTVLTFIDISSSHAAEERVRLGEERLSQQLAESQSTSHMKDEFFAVMSHE
LKHPLNLIQLNAEILRRLPSLRNISAASKAVGTICDAVTSQARIIDDLLDVARIRTGKLK
LKTAPVDLLALLQGIHDVVVSEQHPCPVRLELPADTLPVMIEGDVTRLEQIIWNLLNNAL
KFSPAGNEIRLVLSHDEDHARLQVIDHGVGLSHDSLEHIFDLFSQATPQQGSHSREGLGI
GLSLVRQLVEAHGGTVRAKSPGLGLGCTFEVTLPLCDTQLPQREQGSEPLSEGRLNGIRV
LLVDDSVEVLAVMQELLEMESATVNAFSKPREALDAAAGEEYDIILSDIGMPVMDGHALI
KALRGYVHLRHTPAIALTGYGASADQYKSRQSGFDRHLSKPVGYDELVEAIEALSGSVPY
Download sequence
Identical sequences V9V0J3
WP_024087132.1.23948 WP_024087132.1.28354 WP_024087132.1.65739 WP_024087132.1.7288 gi|568182262|ref|YP_008954879.1| gi|568187640|ref|YP_008960247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]