SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182287|ref|YP_008954904.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182287|ref|YP_008954904.1|
Domain Number 1 Region: 33-287
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 1.01e-46
Family Aldo-keto reductases (NADP) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182287|ref|YP_008954904.1|
Sequence length 302
Comment aldo/keto reductase [Pseudomonas monteilii SB3078]
Sequence
MYARRDVLRAGATLGLLAASPWLHAAAPAGLLTRQVPSTGEALPAIGAGTSGSFEVQAGS
AQYQQLKVVLQAFFEGGGRVIDTSPNYGGADSILGQLLEEGGWHRQCFIATKIAADSRAD
AEAQWAGSLASLRTDKVDLLQIHNLRDWQTQLPYARELKQQGKTRYVGITHYLNSGQDEV
ARIVRSEPLDFIQINYSVNAPDAARELLPLCQDKGVAVLVNRAFDDGRLFARVKDQALPG
WAAEAGVGSWAQLFLKFAISHPAVTTVIPATSRPERQLDQLKAGHGPLLTLAQQQALIKQ
FA
Download sequence
Identical sequences A0A099MZB9 V7D343 V9V0N2
gi|568187665|ref|YP_008960272.1| WP_023663102.1.23948 WP_023663102.1.28354 WP_023663102.1.65739 WP_023663102.1.7288 WP_023663102.1.80759 gi|568182287|ref|YP_008954904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]