SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182297|ref|YP_008954914.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568182297|ref|YP_008954914.1|
Domain Number - Region: 137-321
Classification Level Classification E-value
Superfamily Tropomyosin 0.00497
Family Tropomyosin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|568182297|ref|YP_008954914.1|
Sequence length 326
Comment cointegrate resolution protein T [Pseudomonas monteilii SB3078]
Sequence
MARGGINKVVVQQARQALIARGENPSIDAIRIELGNTGSKTTIHRYLKELNGQQPVASEG
GIALSDVLSRMVGQLATQLQDEADLKIEQAESAFTRQREQLEAQLAIAQQALAAAHQQHQ
IDVAALAAESEKLLSTQSTLQAEQLRSASLNQSLGELQVRLADKEEQVKSLEDKHRHARD
ALEHYRNASREQREQEQRRHEAQLQQLQVEVRQLQQGMIVKQDELTRLHRDNERLLGEHR
QAASACRAQDELLEQRDAQIQGLRTILAQAQGASEEMRRQLDVQAQSLEARRDLCTEQAR
QLQQLEEQLKQRDEALVQCRARLAVD
Download sequence
Identical sequences A0A059USR8 A0A099MZD1 V7DA75 V9V0P2
WP_023661657.1.1643 WP_023661657.1.23948 WP_023661657.1.28354 WP_023661657.1.35335 WP_023661657.1.56258 WP_023661657.1.7288 WP_023661657.1.80759 gi|568187675|ref|YP_008960282.1| gi|568182297|ref|YP_008954914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]