SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182311|ref|YP_008954929.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182311|ref|YP_008954929.1|
Domain Number 1 Region: 17-129
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.22e-19
Family FMN-linked oxidoreductases 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182311|ref|YP_008954929.1|
Sequence length 132
Comment N-ethylmaleimide reductase [Pseudomonas monteilii SB3078]
Sequence
MPGSRSPFPQSPRYRAHHWFSIRELAKRNLAYLHLSEPDWAGGKPLRDEFRQAIRAVYPG
VIIAAGAYTAEKGEDLIGRGLIDAVAFGPCFIANPDLVERLRVQAPLNAHRAQFDYANGA
EGYTDYPFLKQP
Download sequence
Identical sequences A0A099MZE8 F8FWA2 V7D1W5 V9V001
gi|568182311|ref|YP_008954929.1| gi|339487656|ref|YP_004702184.1| gi|568187689|ref|YP_008960297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]