SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182329|ref|YP_008954948.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|568182329|ref|YP_008954948.1|
Domain Number - Region: 37-138
Classification Level Classification E-value
Superfamily OMPA-like 0.000123
Family Outer membrane protein 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568182329|ref|YP_008954948.1|
Sequence length 173
Comment aldehyde dehydrogenase [Pseudomonas monteilii SB3078]
Sequence
MKTRLAASLAAAVLAFAGANLAQAAQVSGAVGATGQGDMTYRIGLSFDWDKKWLESSAGH
LTGYWDAAYTYWEGGEASGAHSLSFSPVFTYEFSGFTYTPYIEAGIGLAAFSKTDVGDQR
LGSSVNFEDRIGFGLKLPGEQKVGIRAMHYSNAGLKQPNDGIESYSLFYSKGF
Download sequence
Identical sequences A0A099MZG8 F8FWC0 V9UYG4
gi|568182329|ref|YP_008954948.1| gi|568187707|ref|YP_008960316.1| WP_013972685.1.23948 WP_013972685.1.28354 WP_013972685.1.56258 WP_013972685.1.65739 WP_013972685.1.7288 WP_013972685.1.80759 gi|339487674|ref|YP_004702202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]