SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568182365|ref|YP_008954985.1| from Pseudomonas monteilii SB3078

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568182365|ref|YP_008954985.1|
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 2.23e-78
Family Aldo-keto reductases (NADP) 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568182365|ref|YP_008954985.1|
Sequence length 273
Comment hypothetical protein X969_13400 [Pseudomonas monteilii SB3078]
Sequence
MRYVKLAGSSVPAIGQGTWYMGEDPARKAAEVAALQQGIELGLSLIDTAEMYAEGGAEEV
VGQAIAGRRDQVFLVSKVYPHNASLRAMAAACERSLTRLGTDCIDLYLLHWRGQHPLEET
VEAFERLREQGKIKRWGVSNFDVDDLRELHNPDCATNQVLYNPAQRGIEFDLLPWCEKRA
LPTMAYCPLAQAGRLLQHPVLAEIAERHGATVAQVSLAWVTRNDGVIAIPKAVTPEHVRL
NAAAGALTLTGEDLRAIDRAFPAPTRKQRLAMV
Download sequence
Identical sequences A0A099N1W0 F8FXJ7 V9V346
WP_013972723.1.1643 WP_013972723.1.23948 WP_013972723.1.28354 WP_013972723.1.56258 WP_013972723.1.65739 WP_013972723.1.7288 WP_013972723.1.80759 gi|568187743|ref|YP_008960353.1| gi|568182365|ref|YP_008954985.1| gi|339487713|ref|YP_004702241.1| 2035968260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]